PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00754.1.g00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 320aa    MW: 35238.6 Da    PI: 5.6631
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00754.1.g00180.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.7e-192572148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    rg+WT eEd+llv++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Zmw_sc00754.1.g00180.1.sm.mkhc 25 RGPWTVEEDLLLVNYIAAHGEGRWNALARCAGLKRTGKSCRLRWLNYL 72
                                    89********************************************97 PP

2Myb_DNA-binding49.88e-1678121146
                                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                 Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                     rg+ T+ E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Zmw_sc00754.1.g00180.1.sm.mkhc  78 RGNITAHEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 121
                                     7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6962072IPR017930Myb domain
SuperFamilySSF466891.27E-3023119IPR009057Homeodomain-like
SMARTSM007173.3E-162474IPR001005SANT/Myb domain
PfamPF002495.2E-172572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-222679IPR009057Homeodomain-like
CDDcd001677.90E-132772No hitNo description
PROSITE profilePS5129422.25573127IPR017930Myb domain
SMARTSM007172.9E-1477125IPR001005SANT/Myb domain
PfamPF002495.3E-1478121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2280125IPR009057Homeodomain-like
CDDcd001673.42E-1182121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MKMAAREQRE MSSEDESPVA GELRRGPWTV EEDLLLVNYI AAHGEGRWNA LARCAGLKRT  60
GKSCRLRWLN YLRPDLRRGN ITAHEQLLIL ELHSRWGNRW SKIAQHLPGR TDNEIKNYWR  120
TRVQKHARQL NCDVNSQQFK DLMRYLWMPR LLERIHSSGS SSPPDVTAGT APPPQQQQPP  180
AWSADDVVAA ANNEVELSCT TAASSVSTDA GIQQQPVVCP PAIVSAGGNV GWSCSDNSID  240
SIKSMSMIDT WCQAPYTGTP PTEYNPAQLG GSAETTCLSE VPGAGLSSTN VYAAADMALP  300
DLGETMWGAD DLWYTQIMGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-24221251103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958743.11e-120PREDICTED: myb-related protein 330-like
TrEMBLK3ZVF31e-120K3ZVF3_SETIT; Uncharacterized protein
STRINGSi030584m1e-119(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330